NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209617_10064751

Scaffold Ga0209617_10064751


Overview

Basic Information
Taxon OID3300027720 Open in IMG/M
Scaffold IDGa0209617_10064751 Open in IMG/M
Source Dataset NameFreshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1514
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameLake Erie, Canada
CoordinatesLat. (o)41.77Long. (o)-81.73Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000473Metagenome / Metatranscriptome1097Y
F000671Metagenome / Metatranscriptome945Y
F002060Metagenome / Metatranscriptome597Y

Sequences

Protein IDFamilyRBSSequence
Ga0209617_100647512F000473AGGMEFINKDKDHFKYGINKWTGEPNKPVFYNKEMALAVRGIKKPVTDLQMDIVKYPEFLCLRVYEDNFIQYAGTKKEMVIDYLQRVKKLIESYGVRCELEGVPSQRILGQGL
Ga0209617_100647513F000671AGGAMEKILCYCCNKSKNKLAVKKSSLLPINLFLCETCISAKFEPRWVIILSGRQLGPEAVKEFIVKKRYIGADIAASELFV
Ga0209617_100647514F002060N/AMEINYLSVLMAISAALVSGMGTALVAGFRDNKKEKVRRSEREQDHLKLELKDLKIELYKIEKELTEWKDKYYAAIQELIGIKAELEATLIELGHFEHHLDELDR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.