NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247836_1071147

Scaffold Ga0247836_1071147


Overview

Basic Information
Taxon OID3300027728 Open in IMG/M
Scaffold IDGa0247836_1071147 Open in IMG/M
Source Dataset NameFreshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyRestricted
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).


Scaffold Components
Scaffold Length (bps)1837
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location
Location NameSpain: Castile-La Mancha
CoordinatesLat. (o)39.9879Long. (o)-1.8737Alt. (m)Depth (m)14
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000710Metagenome / Metatranscriptome925Y
F002287Metagenome / Metatranscriptome574Y
F004838Metagenome / Metatranscriptome421Y
F019128Metagenome / Metatranscriptome231Y

Sequences

Protein IDFamilyRBSSequence
Ga0247836_10711471F000710N/AMANGINMISYRQGIRNKGFQVTVPTTGATQTLSLSGLAKAFEGIILSSTTSAAPATLVNALQLRVTLTINNDVVIDDVVAHELGASVASGITTGFPAFIPFPRALTGQDTILLRVTNSSGASQLLNATV
Ga0247836_10711472F002287N/AMSQVSKLSFVDGKLGAPTSGQQTTRILFNTIEAPGTTSSLSFFKSFQGLTNGQTNLTQNKLDSMESMVIKTVMLTQYSTDGVLQTFGGLVQQTMSIIVGNQTVVKNLPIHFNQGVNGQGYDRLHENAGCGTDFAVSTSALIQIVQPLEIRLVTDIVIPPQVAFEVRIESNAAVYGTGAVVCALSGYGKIFSAGNSF
Ga0247836_10711473F004838N/AMITAQDKILHVASKLGLTSLKDMQASTGAVYDCDTDLSGQIFSSASRHQNPGITNLTDNQFEVNEALLVENIAFYVRASNGNAVNFQLNYGSNAVIVFDLIIGNKRVLKDTPVFASGSPYTFANVANIAGVVVEDNVQFYIPRNQVYMEGAGILIPPQIQWYVDYRIFNVVTGAPIAAGSNTVIGCYLFGTKVLLNFNTSI
Ga0247836_10711474F019128N/ALFLKQPEIAAGMAGYSGYKIAGALLPDLTKEGGLLAENNDFMVSPSMYLQGDMTGEGIYASNYTLAGYEVPGM
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.