Scaffold Ga0247836

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247836_1227889

Overview

Basic Information
Taxon OID	3300027728 Open in IMG/M
Scaffold ID	Ga0247836_1227889 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Restricted
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components
Scaffold Length (bps)	717
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location
Location Name	Spain: Castile-La Mancha
Coordinates	Lat. (^o)	39.9879	Long. (^o)	-1.8737	Alt. (m)	Depth (m)	14
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018714	Metagenome	233	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247836_12278891	F018714	GAGG	MTDYEYQKTLMVGAIIGACFTLLAFYMLKPSPENYTVPPEKNFAIVDTYKGCDVVQWTDGSLATYKYFLHCNNTRPVYGAK

⦗Top⦘

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.