NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209085_1012969

Scaffold Ga0209085_1012969


Overview

Basic Information
Taxon OID3300027741 Open in IMG/M
Scaffold IDGa0209085_1012969 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4126
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (85.71%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Croche, Canada
CoordinatesLat. (o)46.8319Long. (o)-72.5Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041150Metagenome / Metatranscriptome160Y
F043902Metagenome / Metatranscriptome155Y
F054798Metagenome / Metatranscriptome139N
F085623Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0209085_101296910F085623N/AMTKLRTIILEYDLIEIHHNKKLKNKPYLVRVYSYNNSDPHELRLNEDDLKNLYSILKEYKYL
Ga0209085_10129692F054798AGGAGGMIYLYLNETEKLAAIVAELVKLKMGVVAELHGNKWHIEVTQ
Ga0209085_10129696F041150GGAGMGMGNFAVGSFVIEYDDLKKICPEEIKSIEKAKYFNDIGWGTIGQWLSWDDPDQIKDAFYDAILEDESKPDIRLELNVDQIVEDIFQEYEKLIVALKNTFNKKTGLTLYFDHYDEEGGDRYDNPGDKDGCIFCVGGMVQLTPAGEKFKDVISERKWTQFG
Ga0209085_10129699F043902GGAGMTVQQLRNDGYKVRVLHNRLYNGYHAWQNGSRIHTDGITEPDTKGGSTQIIIDSPDGKHFRGLAICSKKENYNKKMGVKIALGRSGVISKIYDQTTNHNS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.