NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209596_1020000

Scaffold Ga0209596_1020000


Overview

Basic Information
Taxon OID3300027754 Open in IMG/M
Scaffold IDGa0209596_1020000 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4033
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001055Metagenome / Metatranscriptome791Y
F001725Metagenome / Metatranscriptome645Y
F090066Metagenome / Metatranscriptome108N

Sequences

Protein IDFamilyRBSSequence
Ga0209596_10200004F001725N/AMASVSKGVTCLYGVAGTVTNLYVQSYSVSSSFNNEDTVQDESGLTKTWRADDRKSEITVEGIVKVGTVPQLGASFSFTLNADSAYPSGSASASFAGWVTKVDEKGGNKEFVKVSVTAVDYEGVSP
Ga0209596_10200005F001055N/AMGTKSIRHIVEQVLKTYLSTETGLTGVSLYTGDSADVMTLPKLVILCESARTPSDLPEGLGNYSCSVRMTLFSNADDTTLTDHRARCAGLAGAMSVDSLPNIKAAFTTSGDATCYDVTVQNEDEGVDERSWATVFSYDVLVVLPA
Ga0209596_10200007F090066N/AGSIAGGPTFLCLISDPVLTQVLEAGGYCDRTQFSVKVTATTSAWTASDGRVGASAALLSGGLPISTLSIGKKITAGGKSVRITSQTYKPGSAWIILVVIDDNQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.