NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209596_1175411

Scaffold Ga0209596_1175411


Overview

Basic Information
Taxon OID3300027754 Open in IMG/M
Scaffold IDGa0209596_1175411 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)933
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003290Metagenome / Metatranscriptome495Y
F010386Metagenome / Metatranscriptome304Y

Sequences

Protein IDFamilyRBSSequence
Ga0209596_11754111F010386N/AASNRTDVYSLVAALATSGIGYIYESATGAISYADSTHRSTYLATYGYTDVTANQALASGIAIQTRAGDVRNSVTVQYGISSGSEVSDEDATSISIYGRLSQIIQTTVKHLADATSQAAFYLALRAYPLAMMQSITFELTNPELDDLDRDAMINIFMGLPLRISDLPLNMNAGSYAGFVEGWTFTAAYNQVQVTALLSPLAFSIQAMKWETVLPLEQWNTVSGVLEWQDATIVA
Ga0209596_11754112F003290AGGAGMTNPTSNFGWQMPTNTDLVTDLPADFAVFGQAVDTSMADLLGGTTGQILAKASNTNMDFAWIANDQGDITGITA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.