NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209296_1085631

Scaffold Ga0209296_1085631


Overview

Basic Information
Taxon OID3300027759 Open in IMG/M
Scaffold IDGa0209296_1085631 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1540
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009334Metagenome / Metatranscriptome319Y
F013757Metagenome / Metatranscriptome268Y
F020008Metagenome / Metatranscriptome226Y

Sequences

Protein IDFamilyRBSSequence
Ga0209296_10856311F009334AGGAGGVAKVDGQEVQIGDWVCFKSDIEQSGKIVAVKQTYAGTSLTLENLSGFSGDYIGGDTITTELARDCWLEG
Ga0209296_10856314F020008AGGAMGVYANTVNAYAMSAARAKVYTMQNTLQSYGQTSYMLNVSTAKFRRDIEAKKVKFIAKLEKEKIAQMQLEIARLQAKQTA
Ga0209296_10856315F013757N/AMLTNCIAKAKLVYNKKLQAYKLVVAFNAHKQFKKDKYGNEKVVYAFPTQAKCAYVSGDLLANNLQNELAAVLPTVYATLRTNSVEFVD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.