NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209296_1110592

Scaffold Ga0209296_1110592


Overview

Basic Information
Taxon OID3300027759 Open in IMG/M
Scaffold IDGa0209296_1110592 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1295
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010984Metagenome296Y
F047641Metagenome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0209296_11105922F010984AGCAGGMLHVGRLEIEGAKKTAEQVIDDAKAIKGVFQWFIGLFTTKPTADASKPVAKKKIAAKQQSYNELETKLFNDIGLQLGTLFDVQQQINDHYHALEEESKNKFNPEQNTSKKAIERVLIELQLEDLMQDVREVMVYAPPQLKNLYSRFLVMHGKIEREQEWARSEMVRRARLARWRKEQDEIRVIETISGVIAVMFISMFFGWLMWQLRSWSTGY
Ga0209296_11105924F047641GAGMEKLQLSTQLLNSIMGYLGTRPYQEVFQLIEAIQKEAKNQPTPEPTE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.