Scaffold Ga0209462_10000037

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209462_10000037

Scaffold Ga0209462_10000037

Overview

Basic Information
Taxon OID	3300027761 Open in IMG/M
Scaffold ID	Ga0209462_10000037 Open in IMG/M
Source Dataset Name	Agave microbial communities from Guanajuato, Mexico - As.Sf.rz (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11818
Total Scaffold Genes	15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (40.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location
Location Name	Guanajuato, Mexico
Coordinates	Lat. (^o)	21.7658	Long. (^o)	-100.163	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027211	Metagenome / Metatranscriptome	195	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209462_100000373	F027211	GAGG	MVRTYWLVPVFYEASGHLDLQPFARTDRVEACRPRAMWVDCTV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.