NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209288_10003557

Scaffold Ga0209288_10003557


Overview

Basic Information
Taxon OID3300027762 Open in IMG/M
Scaffold IDGa0209288_10003557 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4501
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (90.91%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Cottonwood Lakes Research Site Near Jamestown, North Dakota, Usa

Source Dataset Sampling Location
Location Namenear Jamestown, North Dakota
CoordinatesLat. (o)47.0991Long. (o)-99.1044Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018696Metagenome / Metatranscriptome233Y
F019616Metagenome / Metatranscriptome228Y

Sequences

Protein IDFamilyRBSSequence
Ga0209288_100035572F018696N/AMDEFEQFEGGVAVHLPGGATKHIATPDGYTDAAFRGTLAAFHTAYMRNGKRPSVDEVHELWPKLSKKTISGIVGTLEFGEALAHRGIHWDAKDGLSMEQQTVLLKLSDPFDRRGLASKLKDLGVPMPRFQAWLKQPLFSELYNQHTRNNYEEALPAIRQRLIGNAEAGDQRAIELVFAMTGEWNPNQQHLEDARTIVLKVVEAIIRHVKDAKTREAILSDVSMYAGTLATMNQQKILET
Ga0209288_100035576F019616AGGAGMDVKNPYVRLRELCGTSQKGFATKHGFGKMTMVYLESGMYTRVSDRQSIALGRECNEKGVDAHEVLREEYGATSLNEAYLAWRSEDRKVRAPSVLAKASPPFSGSDDVSPVAQFVKDTAGSLQGFCKLLKIPSITMTRYIRGETSTVPDALWSALEDVKYPHAVALADAQLGWLEGRAL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.