Scaffold Ga0209768_10106606

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209768_10106606

Scaffold Ga0209768_10106606

Overview

Basic Information
Taxon OID	3300027772 Open in IMG/M
Scaffold ID	Ga0209768_10106606 Open in IMG/M
Source Dataset Name	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1370
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location Name	Lake Michigan, USA
Coordinates	Lat. (^o)	43.1998	Long. (^o)	-86.5698	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093534	Metagenome	106	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209768_101066062	F093534	AGCAG	MLDLGELLKVAAEDTKSEYPLEFVYASFVKEVQMPGSKFYRYGNTVYIVHASPKNPRKGMFRALNADTPANFLASAYAFPVDAYKSGFDTLVTQFSNQSLLNIFRQVMKNPPNPGMGYNVSMLADGQYQVALQLGNKREGAQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.