NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209709_10081320

Scaffold Ga0209709_10081320


Overview

Basic Information
Taxon OID3300027779 Open in IMG/M
Scaffold IDGa0209709_10081320 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1754
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)75.235Long. (o)-150.0691Alt. (m)Depth (m)79
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011704Metagenome / Metatranscriptome288Y
F015261Metagenome / Metatranscriptome256Y
F024333Metagenome / Metatranscriptome206Y

Sequences

Protein IDFamilyRBSSequence
Ga0209709_100813202F024333GGAGMSIGLKDKLRGWIDDVKDKMFNVFGHDKTEKEDLYETRWVWYHSALVIELFIIIVLLWYIAI
Ga0209709_100813203F015261AGGAGMPVNIIWEDGDATVSILCDGCDKEYEILTNDTDGLELCSFCGHYLEVESETGETNESEEDSWN
Ga0209709_100813206F011704N/AMNIDNFQELIDLTDYLATSNEYLIRKFTEGGNYLIIDTYGDFLIIERDEVDTVFSTIWNDLYGPISEEIPHILN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.