NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209500_10093458

Scaffold Ga0209500_10093458


Overview

Basic Information
Taxon OID3300027782 Open in IMG/M
Scaffold IDGa0209500_10093458 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1502
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074452Metagenome / Metatranscriptome119N
F080943Metagenome / Metatranscriptome114N
F083781Metagenome / Metatranscriptome112N

Sequences

Protein IDFamilyRBSSequence
Ga0209500_100934583F083781GGAGGMININREKFEKEILDLAKKGNGNSPSLTGGSLYVEMIDTDHAELLRADLEDFTNANWGDGTKTSPYSTSVKMYKLADQNGRTEFVYDFVPSATAEDLPPEVDMMLCLEAEIARGK
Ga0209500_100934584F080943AGGAGMITDTTKARLRELEGQRITLEDELERLAYTNNFARIAELEGELFDVKDSIKKITAGHWFEDISREELLKEEATLQ
Ga0209500_100934585F074452N/ARSMRMPVCPTTKDLVDMVRLGIDPFTRAEILETQRAQDYWEMSYVDESNRIRYRLSCVLVEEEILDLLYCHGYITANQQAATINQTRRTE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.