NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209972_10015423

Scaffold Ga0209972_10015423


Overview

Basic Information
Taxon OID3300027793 Open in IMG/M
Scaffold IDGa0209972_10015423 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4887
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location
Location NameUSA: Ohio, Lake Erie
CoordinatesLat. (o)41.69957Long. (o)-83.2941Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000311Metagenome / Metatranscriptome1326Y
F000450Metagenome / Metatranscriptome1126Y
F031384Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0209972_1001542311F000450AGGCGGMGDRANFGFVQPNGNTIVLYGHWAGHQMLGKLADAVIAARPRWSDPAYATRIAISQIIGNDWSDETGYGLHVNEISDNEHKIAIVDWDQQIFSLHEEDTFANTDNKVRGMKNEAIFTMDLSTFCEKYALEGMLVN
Ga0209972_1001542312F031384AGGAMPNWCYNGLTIEGNPEQVNKLVEQMNQPYKQVHDNWNMETHQMEKKLSTYPNPVFAFHNIYNHIQDGVSDEVYLGQPPR
Ga0209972_100154238F000311GGAMYFELTAPNQIALQRAFWSAEMMGLDPMLISPLTFNIGTGSIEKVSSIRDTYNLKETYVSDYEPTGYTRR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.