NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209107_10042354

Scaffold Ga0209107_10042354


Overview

Basic Information
Taxon OID3300027797 Open in IMG/M
Scaffold IDGa0209107_10042354 Open in IMG/M
Source Dataset NameFreshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2590
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameLake Erie, Canada
CoordinatesLat. (o)41.77Long. (o)-81.73Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007029Metagenome / Metatranscriptome359Y
F023592Metagenome / Metatranscriptome209Y
F029049Metagenome / Metatranscriptome189Y
F030767Metagenome / Metatranscriptome184Y

Sequences

Protein IDFamilyRBSSequence
Ga0209107_100423541F023592N/AILIGLGACALGFLFMVIGYSVGFKHGHGEGFVRGRAIAQALKDAELI
Ga0209107_100423542F007029GGAGMGFLDNYEDVNARIKRFRSEYPSGRLVAYIEDIDILKGTVLVKAEAYREYEDIVPSAVDYAFGNVASLTNNMKRWLIEDTVTSAYGRVIGLLTPSLEHSSRPTAQDMQKVESLPADSDPWSTKASIEDMATMASSLLEIGTQLGGELVPEGPRCSHGTMIWAEGTAKATGKPWAAYKCSERVRANQCNPIWHVMTSSGQWKPQV
Ga0209107_100423543F029049AGGCGGMVMRTMSRVAKVILDRSQEITAHRVGLERTVIRNADPKDASNFGQTYQNWHELVWQEAEGCGAEMAVANYFGDYAFTPNVDNAHDTADVGENIEVKWTKHANGHLILQNRGAGRPNDVAILVTGLSPVYILMGWMPVHMAKVAKYKHPYQNNYWVPRSNLFEMQYLKRSNYGV
Ga0209107_100423544F030767GAGGMGYKTKCRLCGKITEHIERVVTDNLPPYVKSLQCIKCGVMGIVMVEDVKDA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.