NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209091_10004123

Scaffold Ga0209091_10004123


Overview

Basic Information
Taxon OID3300027801 Open in IMG/M
Scaffold IDGa0209091_10004123 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11417
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)77.0991Long. (o)-150.2252Alt. (m)Depth (m)58
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002716Metagenome / Metatranscriptome535Y
F042286Metagenome / Metatranscriptome158N

Sequences

Protein IDFamilyRBSSequence
Ga0209091_100041231F042286GGGGGVSGTFPTNPNFQALSFQDNRPTLINQTLSGKRQVRQIGGQYFTFSVSMPPMEQLEAQAVF
Ga0209091_100041238F002716GAGMETEEDFASYLDVDYGHGVTAVFTNTGGTASTINVILNNEYIEQDGSGVAIEATKPVAFCRSMDIPNIAHGNSLAVSAIKDIEGNILKSAQSYVVASIQSDRTGFTALILEKI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.