NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209091_10249484

Scaffold Ga0209091_10249484


Overview

Basic Information
Taxon OID3300027801 Open in IMG/M
Scaffold IDGa0209091_10249484 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)863
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)77.0991Long. (o)-150.2252Alt. (m)Depth (m)58
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000060Metagenome / Metatranscriptome2944Y
F081747Metagenome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0209091_102494841F081747AGGAGMKLYKILAANYETYFGTRENPIDRSYVTRIAQTPSCDAFLFLCKDAQSSQTGLSLLSTVPNGFDFTYCQEWGLTINDAVVDKVIIDLRKKKLWN
Ga0209091_102494842F000060N/ANTEFNYRYQVIGDTAWEKIKTLKGFLEGRMRAVVLEQVAELQYQSKLAKLKRLENEAGLQEDILELKAEIMETESQQETAHEAFRLNEAEIKIINKLLKELYVIAEPTRIKGYTDEEMFEANAANEFTVNIGREIQAEMIANGRPSAAKIRNAMSNPHTWNALKSVGLIPKEPKILEGHINPKLKIELKGVEDEVI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.