NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209229_10004411

Scaffold Ga0209229_10004411


Overview

Basic Information
Taxon OID3300027805 Open in IMG/M
Scaffold IDGa0209229_10004411 Open in IMG/M
Source Dataset NameFreshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5872
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (23.08%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameSandusky Bay, Ohio, USA
CoordinatesLat. (o)41.474889Long. (o)-82.854137Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001345Metagenome / Metatranscriptome718N
F004837Metagenome / Metatranscriptome421Y
F006621Metagenome / Metatranscriptome368Y

Sequences

Protein IDFamilyRBSSequence
Ga0209229_100044115F001345N/AMASAETVILDLYRTGEIRKACLTITGGDPLWRDLEQECVLILLEKDPAKILQIHGQGYFKFYVVRLLLNLYRGKNNQFAQKYRHHDLLEELDPDSPIPQAEYDSLMDDLWAIAEAEMDTWAKDGAFPYDKELLRLHLRTGNMKKLSRDTGIPYRSIIYSIDQAKAKIKAAIQSHGHADISPID
Ga0209229_100044118F004837N/AMTQAEYLTAQKHRHYWEQYQAALFMRLSPEAVHDLQTILVAHGRPNTNWWCADCVKSALQYIYQEADQFAEANHHTVTHALTNQSPQR
Ga0209229_100044119F006621N/AMPSPTKAPNDEAQVQARMDSLMMVITTLCDCIGAVDDSNAPNQYEVKMKIVNKISDLIDKIEY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.