NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209229_10015109

Scaffold Ga0209229_10015109


Overview

Basic Information
Taxon OID3300027805 Open in IMG/M
Scaffold IDGa0209229_10015109 Open in IMG/M
Source Dataset NameFreshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3286
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameSandusky Bay, Ohio, USA
CoordinatesLat. (o)41.474889Long. (o)-82.854137Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001055Metagenome / Metatranscriptome791Y
F001298Metagenome / Metatranscriptome727Y
F001725Metagenome / Metatranscriptome645Y

Sequences

Protein IDFamilyRBSSequence
Ga0209229_100151091F001725N/AMAAISNGTTCIYGVAGTVTNLFVQSYSLSSSFNAEATVVDETGITKTHRLDDRKSEITIEGIAKTTTMPVLGAALSFTVNTLSAYPSGSASVSFVGTITKIDDKGSNKGFTA
Ga0209229_100151092F001055AGGMGTKSIRHIVEATLATYLSTQTGLTTVAFLTGDSATTQTLPKAVVLCESARSPNDLPEGEGNFSCSVRITLFSNADDTTLADHRARCAALSGNMRDLTSIKAAFVTSTDAACYDVTVVSEDEGIDERSWATSFAFDVLVVLPA
Ga0209229_100151095F001298GAGGMGAFFVPPTNPGKYRMSLYGTEFLNDAKEMVADFGVAGSANSGAITFSCLISDPAVSTVLEAGGYMERTQYSVRLPAVTASWSQPDGSIGASAALLSSGAPIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.