NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209229_10089911

Scaffold Ga0209229_10089911


Overview

Basic Information
Taxon OID3300027805 Open in IMG/M
Scaffold IDGa0209229_10089911 Open in IMG/M
Source Dataset NameFreshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1382
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameSandusky Bay, Ohio, USA
CoordinatesLat. (o)41.474889Long. (o)-82.854137Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000473Metagenome / Metatranscriptome1097Y
F000671Metagenome / Metatranscriptome945Y
F066776Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0209229_100899112F066776AGGAMIHLTSKGVEVFIDKSLTKTQEAFWNNYDLVIWKKDSGGYTSLKGLFRKDQWGTAETISVDEKGIWKLPLKYVKHFK
Ga0209229_100899114F000473AGGAMADKNYFKHGVNEWTGEPNKPVFYTQEMANKVREIPKPGMLLMDIVKYPEFIAIRLYEDNFIQFDGSAKERVIDYVNKVKKLIESYGVRCELEGRPSERIL
Ga0209229_100899116F000671GAGGMEKILCYSCNKTKNQLNVKKSTLLPISLLMCETCVSSKFEPRWLVILAGRQHGAESVREFILKKRYIGSDISASELLV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.