NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209229_10142568

Scaffold Ga0209229_10142568


Overview

Basic Information
Taxon OID3300027805 Open in IMG/M
Scaffold IDGa0209229_10142568 Open in IMG/M
Source Dataset NameFreshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1080
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameSandusky Bay, Ohio, USA
CoordinatesLat. (o)41.474889Long. (o)-82.854137Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058813Metagenome134N
F065732Metagenome / Metatranscriptome127Y

Sequences

Protein IDFamilyRBSSequence
Ga0209229_101425681F065732GGAGGMTDDLSMDERIAWARRSGLTDERIAFLLACPKYTRTGRNDKPAYIKADNPNHHLQKLGDCWWLRIRRRKTNIVHNLGKDLDTARKHRDEMLAAYDAGKPIPHLNQ
Ga0209229_101425682F058813AGGMSTMSAPTLVLISGFARAGKDTLATGILEWSTRPSRKTNFADYLKDAGNDFLMSLNLEGNFHDERFKVLHRDFLVAGGRLARSLDVNIFAKNLANFCPIQMAPGELAPETVVCSDLRYANEVSVCQDVLIDLGWKVRTIYVATAGIGPANQEEMDSILEIREKHAFDIEMTFAPNSRNTIMQEGRYIAKTWRL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.