Scaffold Ga0209229_10351191

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209229_10351191

Scaffold Ga0209229_10351191

Overview

Basic Information
Taxon OID	3300027805 Open in IMG/M
Scaffold ID	Ga0209229_10351191 Open in IMG/M
Source Dataset Name	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	645
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium 20-58-5	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location Name	Sandusky Bay, Ohio, USA
Coordinates	Lat. (^o)	41.474889	Long. (^o)	-82.854137	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028782	Metagenome / Metatranscriptome	190	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209229_103511911	F028782	N/A	MPNVTITQLPQATPLNGTESVAIVQGGQTRQTTTGAIANAPNLQQTFLTIVQEPTLPQSRYLSTGTGLGLQDNGAQSYYRLTLNGASGSLEVALTGIIAKTNSNTVAARTITVGS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.