NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209208_10019311

Scaffold Ga0209208_10019311


Overview

Basic Information
Taxon OID3300027807 Open in IMG/M
Scaffold IDGa0209208_10019311 Open in IMG/M
Source Dataset NameHost-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7874
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Communities From Peat Moss Sphagnum Species From Minnesota, Usa

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001145Metagenome / Metatranscriptome765Y
F001219Metagenome / Metatranscriptome744Y

Sequences

Protein IDFamilyRBSSequence
Ga0209208_100193114F001145N/AMTLEFFSLVLNHEEAFIEFNTNILETNLINILLLIGLLLYANKVSFSSNLESRQKEILQTIENVQKDVLNASNYYYNAEKGFTQSFFWLQSWKLLYENEKIEVVNLKYNIVKNGIYEIFSTTENLIKNFEKKAFLSLQRYLILVTASKILRKFFFLSEKEQSKILETTISKLGGFKK
Ga0209208_100193115F001219GAGMKLLILITMTLINTFFLTENGLFDFDLTFPAEAFLFFLFSLVVTFSFLSPISKQLDERSEFINYTLRKSTILLTFGYEKLCKCVEILTEESNELNRQLKITRNYTNSKFDEEISFVQKENLRILSKLKGDLSVKSAYLFSNITNELNLLTDTFFKKKFQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.