NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209354_10190444

Scaffold Ga0209354_10190444


Overview

Basic Information
Taxon OID3300027808 Open in IMG/M
Scaffold IDGa0209354_10190444 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)833
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000324Metagenome / Metatranscriptome1299Y
F002689Metagenome / Metatranscriptome536Y
F069831Metagenome / Metatranscriptome123Y

Sequences

Protein IDFamilyRBSSequence
Ga0209354_101904441F069831N/AMDPITAFAAAQAAVAGIQKAIKLGKDINGLVGEFGKFFDAKDVVQKAAN
Ga0209354_101904442F002689AGGAMDTIDMTAAKLMTHEEICAVRYEQINARLKRIEGILLKVAGVMIVAMAGVIWASLLRH
Ga0209354_101904443F000324N/AVITSPPRFTVTYDGATLNVFHANKGEGLPRHAHSYAHLTMCHSGSCVVRKEGRELLMTKDTQPVNLLAVEWHEIEALEDGTVFVNVFAEGKY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.