NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209742_10044715

Scaffold Ga0209742_10044715


Overview

Basic Information
Taxon OID3300027814 Open in IMG/M
Scaffold IDGa0209742_10044715 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1460
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location NameWhite Oak River estuary, North Carolina, USA
CoordinatesLat. (o)34.640199Long. (o)-77.109447Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012534Metagenome / Metatranscriptome280N
F070979Metagenome / Metatranscriptome122Y
F100031Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0209742_100447152F070979N/AMKKTKQEIINEVNKSFSFLCWPYWMDRKGRIHDSGSKLQAPSSKQQALDKITIL
Ga0209742_100447153F100031AGGMITQKMYNEYLDKMNDADWKNIRTKIEKRYPETITWPEKMFRMYCSAVVRSGFRKEGLN
Ga0209742_100447154F012534AGGAMDQKDKDIRWAASQFLYEDLPEDYQNWPDIKLFKFLQDYAWKPFENYSGQWLWAHIQDLAVSMRKYAQEN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.