Scaffold Ga0209726_10000470

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209726_10000470

Scaffold Ga0209726_10000470

Overview

Basic Information
Taxon OID	3300027815 Open in IMG/M
Scaffold ID	Ga0209726_10000470 Open in IMG/M
Source Dataset Name	Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	75731
Total Scaffold Genes	101 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	70 (69.31%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Coal-Tar-Waste-Contaminated Well In S. Glens Falls, New York, Usa

Source Dataset Sampling Location
Location Name	S. Glens Falls, New York, USA
Coordinates	Lat. (^o)	43.292222	Long. (^o)	-73.604444	Alt. (m)		Depth (m)	5.4
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094578	Metagenome / Metatranscriptome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209726_1000047089	F094578	AGTAG	MESKERPKWPLHRLKSMYFAMHCWKCKKFELPIEKYKRLCENNIQKMIDNLEVKEMKFKEFNTIIKNSIFCKFEKRDFSNNCPICKKLGCR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.