NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209726_10009665

Scaffold Ga0209726_10009665


Overview

Basic Information
Taxon OID3300027815 Open in IMG/M
Scaffold IDGa0209726_10009665 Open in IMG/M
Source Dataset NameSubsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9998
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (61.54%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Coal-Tar-Waste-Contaminated Well In S. Glens Falls, New York, Usa

Source Dataset Sampling Location
Location NameS. Glens Falls, New York, USA
CoordinatesLat. (o)43.292222Long. (o)-73.604444Alt. (m)Depth (m)5.4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004841Metagenome / Metatranscriptome421Y
F061236Metagenome / Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0209726_100096652F061236AGGAGGMVDAEQRQEKGASLMFIGLAVWVAGLLVLFYLPAGFRLGHQGNSEAILIALGVLGAVLMGCGWRMRRGA
Ga0209726_100096654F004841N/AVAQKPKSSRKRDRAPRIRVPNNERAIFIVDESKFVGVIQRLSLTGGSAILAKGPIHQGTMGDMILNTVFGKVTAHVEFLQTGADGIPLAQAFRFLAMDDDSSRRFSAAAKQMEEEGFSDAPAKTSPLAGQASQTLSQLLHSVRRLAATIYSTRSSGAKG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.