NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209726_10012929

Scaffold Ga0209726_10012929


Overview

Basic Information
Taxon OID3300027815 Open in IMG/M
Scaffold IDGa0209726_10012929 Open in IMG/M
Source Dataset NameSubsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7976
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Coal-Tar-Waste-Contaminated Well In S. Glens Falls, New York, Usa

Source Dataset Sampling Location
Location NameS. Glens Falls, New York, USA
CoordinatesLat. (o)43.292222Long. (o)-73.604444Alt. (m)Depth (m)5.4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000280Metagenome / Metatranscriptome1383Y
F019913Metagenome / Metatranscriptome227Y
F090360Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0209726_100129292F000280GGAGMARRRRIPARPLAGYRDVGQGVRHSRRNVTRAWIILAFLIAGYLTWTLIVYFLEPGLR
Ga0209726_100129293F090360GGAMAAAPPFVSYATMSEAIVAIADWPVLYASLQTHKAHVQEYPGCQRLEVYVAVDDDGSMRLHCYTTWDTPEQLEVFVERGYTFERMLADVGVTGVERSLVMEKLF
Ga0209726_100129294F019913AGGAGMGMPSGDSPQKAQQFYEYLLAHHETERRVQAWYVDWYSLAWVWGFVAALSLILLWWVWQYRTTRQKAGLYPVDSWSGYTSELAGPASLFFVLLTAIIVGFAVAVIVGHIVNGQIF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.