Scaffold Ga0209990_10012250

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209990_10012250

Scaffold Ga0209990_10012250

Overview

Basic Information
Taxon OID	3300027816 Open in IMG/M
Scaffold ID	Ga0209990_10012250 Open in IMG/M
Source Dataset Name	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5194
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location
Location Name	USA: Ohio, Lake Erie
Coordinates	Lat. (^o)	41.69957	Long. (^o)	-83.2941	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047555	Metagenome	149	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209990_100122506	F047555	GGCGG	MSLTATVDARVQARTRATSGLTASLDDHTLSFFFDVGDCTKVWSDRRTFASGFDDIDFSTIGVGTVKLLCLKNLSTTSQIALSAGWTGSQFSVFRQDATSWNFSPMINLGSLSLRGYPIREGGAFLLSCPNSAGFATTSGGSILRVGGTTGQQYEIYVMGT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.