NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209040_10178697

Scaffold Ga0209040_10178697


Overview

Basic Information
Taxon OID3300027824 Open in IMG/M
Scaffold IDGa0209040_10178697 Open in IMG/M
Source Dataset NameBog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1120
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada

Source Dataset Sampling Location
Location NameCalvert Island, British Columbia, Canada
CoordinatesLat. (o)51.62Long. (o)-128.09Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002492Metagenome / Metatranscriptome554Y
F053513Metagenome / Metatranscriptome141Y
F075219Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0209040_101786971F053513N/AVVISNSAVGIGGRWDTFQSRLRERRKEAVSACSTCSNESASKRGSESTDTLRKAV
Ga0209040_101786972F075219GAGMTSKTPGQSLPVPMNLKRTFENAVRDIYQTGLTGKPSRYRTPIVQRAGTAAAESSANAQKRALTDAAKALAQLWKVSHSSSSR
Ga0209040_101786973F002492N/AHSSRDPRSSARAWHDLYQAALFETDRNRIPERIAEAEKAILARIKELFVVTADHVEEDQILDDALYALRALRNCVVSEASAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.