NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209039_10000995

Scaffold Ga0209039_10000995


Overview

Basic Information
Taxon OID3300027825 Open in IMG/M
Scaffold IDGa0209039_10000995 Open in IMG/M
Source Dataset NameBog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)27587
Total Scaffold Genes29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)24 (82.76%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada

Source Dataset Sampling Location
Location NameCalvert Island, British Columbia, Canada
CoordinatesLat. (o)51.62Long. (o)-128.09Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000775Metagenome / Metatranscriptome896Y
F098497Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0209039_1000099516F000775GGAGGMKNLDSVFAAYIIGWGVFFLFYVTIAKRTADLRAEVERMKARLSTHE
Ga0209039_1000099525F098497N/AMKSEVNSCHLEDVPGSRAIRKLFVLLSICTASLVDLRFLNTMSPTISLPCDGCGQSASPVHLMRRLQRLEWTTRYRPVHIQALLLGGISPATDAAFLYSPEGNLQGEASNLLDALQIPRTGKSADAILTEFQKRGLLLTHVLECPLEPGVAPSAAQQLLEKQLPAVIARIRRSLRPKRLVLFSSELAPLAVKFTEAALGTPVFTGQYGPLLLDGTLTESQMESLRLLLPTGNLS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.