NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209060_10143398

Scaffold Ga0209060_10143398


Overview

Basic Information
Taxon OID3300027826 Open in IMG/M
Scaffold IDGa0209060_10143398 Open in IMG/M
Source Dataset NameSurface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1109
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire.

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Centralia
CoordinatesLat. (o)40.7999Long. (o)-76.3402Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011952Metagenome / Metatranscriptome285Y
F026928Metagenome / Metatranscriptome196Y
F075137Metagenome / Metatranscriptome119N

Sequences

Protein IDFamilyRBSSequence
Ga0209060_101433981F011952N/AHEAMDKIEPAIRAAAEAGRSAMTGEWRNCRCQCGTAHPADAGVCDGRAVMTRSVGGTDISLCAPCAVAQGVAEMTL
Ga0209060_101433982F026928N/AMFGQLCVALLEAEGEGLAVLDAALPAVVPEVEAVVDVVDEVVDDGVEWLVAALATARLPPNPTPSAPAPTAVPIMILPSLDLNVIASSRSGEGPAHRTPTLALAELR
Ga0209060_101433983F075137N/AINGNRVAALGQAYTRTGTVPLAELSVDGGSSWQQVPFSSPGPDTTFTALTASSGGFTAAGQFGAPGQQQVAAWTSVLGTSWTPARIGGLTGPQTGGSYRISALAPSGTGVTGIGSLATQASQEVFTVTLPAR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.