NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209692_10136399

Scaffold Ga0209692_10136399


Overview

Basic Information
Taxon OID3300027828 Open in IMG/M
Scaffold IDGa0209692_10136399 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1169
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Atlantic Coast Under Amendment With Organic Carbon And Nitrate

Source Dataset Sampling Location
Location NameAtlantic Coast
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032660Metagenome / Metatranscriptome179Y
F037230Metagenome / Metatranscriptome168Y
F051139Metagenome / Metatranscriptome144Y

Sequences

Protein IDFamilyRBSSequence
Ga0209692_101363991F032660N/AMQELDRVVHQWCDDNDRWMYIEYDRDGMVMGLNFMQGDDYEFFKKDWCVSDQGMTEFYKQ
Ga0209692_101363992F051139N/AMQKAELELPVKQFHQLHDLLGDILDHEAETNDFNMENSDIELMEDIRTELFNQIPDEEPIEITYAFTTAVDAHQVTPLKLYEIKRCSDGSGFLLKNDRRSEVYCIEKGCSHLSSDQSKNWNLITITNN
Ga0209692_101363994F037230N/AWSGICEDFDLDSGDISPEQSFEIDRALGNINEVLHNFIDQNKSGVHLGQATLTNTEHNVLMVALDHMYEHLDDLVGDLETFEEENTNLKRKDAVKSLKEMFNL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.