NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209491_10137264

Scaffold Ga0209491_10137264


Overview

Basic Information
Taxon OID3300027832 Open in IMG/M
Scaffold IDGa0209491_10137264 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2236
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica

Source Dataset Sampling Location
Location NameLake Bonney
CoordinatesLat. (o)-77.714Long. (o)162.445Alt. (m)Depth (m)83
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018696Metagenome / Metatranscriptome233Y
F019616Metagenome / Metatranscriptome228Y

Sequences

Protein IDFamilyRBSSequence
Ga0209491_101372641F019616AGGAGMTKNPYVRLRELCGMSQKKFADKHDFGKMTMVYLESGMYTKVSDRQSIALGKECAEKGIDAKTFLVAEYGFSSLNAAYLVWRSEDRKLRSPSVLEKASTPFDSSLEASPVAAFVRQTTGSLQGFCKLLKIPSITMTRYMRGETVKVPDALLSALEDVKYPHAQALFDAQAAWQEQQ
Ga0209491_101372644F018696AGGAGGLTDEFEQFEGGVAVQGPAGTSLHIATPEGFTDTAFRGTLAAFHTAFMRNGKIPTVDEIYKLWPKLTKKVISGILGTSEFRDALDHRGIQWDVKDGLTMQQQTVLLKLSDPFDRRALATKLKDLTVPMPRFQAWLKQPLFFEMYNKQTQQNYTEALPAIRQRLIGNAESGDQRAIELVFAMTGEWNPQQQHLDDARTIILKVVEAIITHVKDAKVREAILADVSLYAGTVSTIGHTKSLES
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.