NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209092_10000019

Scaffold Ga0209092_10000019


Overview

Basic Information
Taxon OID3300027833 Open in IMG/M
Scaffold IDGa0209092_10000019 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)128134
Total Scaffold Genes143 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (9.79%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota → Megaviricetes → Imitervirales → Mimiviridae(Source: IMG-VR)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameFram Strait
CoordinatesLat. (o)69.2303Long. (o)7.7302Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017048Metagenome / Metatranscriptome243Y
F031650Metagenome / Metatranscriptome182Y
F049219Metagenome / Metatranscriptome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0209092_10000019110F017048N/AMSSFNYEPSKSSLRADTVVEFVNRSLLEFKMNEIPGMGPASIQKFGDHGIYTPAQIVAKFLSFVDSQDVTAKNVCEQFYNWANPIMGKANTHNLTFALANYAGEHGLFRYE
Ga0209092_10000019112F031650N/AMDTEMPQMTEVEFDQLKQDYANAIPEGDAIRAQLKSFNKEQKERHAKIYQYMRENNIMSADLGGVTFEREEKTTVPSVSIKTLEEIVENPAVVEQYKRDYAKTKESLKVRKPKRQRTDDASAE
Ga0209092_10000019141F049219N/AMIQVESDKFISSRLTSLEKGVTVLDNRVSALDDKVSHVIQMNSEMMIQSNENFREMRQQMTDTRTELKKSIRQIRGSFSTKCQLMMFAMGLATWTLFMAWVMWA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.