NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209092_10001762

Scaffold Ga0209092_10001762


Overview

Basic Information
Taxon OID3300027833 Open in IMG/M
Scaffold IDGa0209092_10001762 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)20607
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)22 (84.62%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameFram Strait
CoordinatesLat. (o)69.2303Long. (o)7.7302Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009212Metagenome / Metatranscriptome321Y
F021734Metagenome / Metatranscriptome217Y
F070879Metagenome / Metatranscriptome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0209092_1000176212F021734GAGGMHIVAIVALLGGVGYGIDNDWKVAKAYKSYENCRVDHPKVQNTMTSWQYDPCNLVAYKLQNK
Ga0209092_1000176213F070879GAGGMLGFCPFASAPFASTGSGAIVRQQASFVGEAIVNANANADWSNKADIVGEAILQTNSTIAGSGWVRQNPNTPEWDMDKSQDWNQIK
Ga0209092_1000176222F009212AGGAMIEEESIQRIVDDESFKEAMADLVKTHVNMLINSDVDDKVAREICYMRITTVNEIIAHLQSIADGKKIEDNKWEF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.