NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209515_10029048

Scaffold Ga0209515_10029048


Overview

Basic Information
Taxon OID3300027835 Open in IMG/M
Scaffold IDGa0209515_10029048 Open in IMG/M
Source Dataset NameSubsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4847
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Coal-Tar-Waste-Contaminated Well In S. Glens Falls, New York, Usa

Source Dataset Sampling Location
Location NameS. Glens Falls, New York, USA
CoordinatesLat. (o)43.292222Long. (o)-73.604444Alt. (m)Depth (m)5.4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000512Metagenome / Metatranscriptome1064Y
F000696Metagenome / Metatranscriptome931Y
F000739Metagenome / Metatranscriptome913Y

Sequences

Protein IDFamilyRBSSequence
Ga0209515_100290484F000512GGAMMEVLREKHEVSESVALRLACAGGRNRFGEPNYRASWGWNRLAWIGGKFEERDPQTGSLVREVVELRQEPKYPAVNRWHIERWVPPEAYGPPRAWYAQTVEIAGGRSVPALGPYPSRGEYEHCLTLHGKGGEFLQLTATAAEYIARAIEWSRRQPRRMRRDVLQKRLEQDDREYEEFAYGVLDASAPAFHGLPFVSIPRSL
Ga0209515_100290485F000739AGGAMTRLHVWLKGIFAAAVSGASGGILTGFAAVGIDPQHFNLQAGIGSTLRIGAAAAVINAVIGVAAYLQKSPLPEE
Ga0209515_100290486F000696GAGGMPVVGSSAYNTAGQITSLIRSLLNDSQGNLFTDSVLMPYANAAYRSVQRALGNAGAGGFLTDNLLIIVPALAAVDPSVQVSITDATPPPNQLPTDLLAPAKIWERPSGSSQEFIEMVDLTRHGGLPSRPQGVTLSVWEWRGDGIYFLGATRDTQIRVRYLKAFPDLADATSPVLVRNAQEAIAYSAAAMAAWARGSPLAEKWDDAAVDATEDLVRAAVRREQHSARRRRPFSWRSGYTPF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.