NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209089_10122734

Scaffold Ga0209089_10122734


Overview

Basic Information
Taxon OID3300027838 Open in IMG/M
Scaffold IDGa0209089_10122734 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1583
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.Bin183(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)73.2247Long. (o)-150.2247Alt. (m)Depth (m)177
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051449Metagenome144N

Sequences

Protein IDFamilyRBSSequence
Ga0209089_101227341F051449N/AVTKNEIYTAIALITIVLISVLWKEELKYRRNFVSVKSSIELKTESPQDSINAVPTKGYLGKAKLDPKGWLEKYEKLIIFKSNDA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.