NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209089_10262346

Scaffold Ga0209089_10262346


Overview

Basic Information
Taxon OID3300027838 Open in IMG/M
Scaffold IDGa0209089_10262346 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)997
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)73.2247Long. (o)-150.2247Alt. (m)Depth (m)177
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049037Metagenome / Metatranscriptome147N
F060975Metagenome / Metatranscriptome132N

Sequences

Protein IDFamilyRBSSequence
Ga0209089_102623461F049037N/AESPCDTCHNYWICVEGSRACSDFKLFYDTGKITHHDRSPNWYIDLPSMAITVRELSERCGFGKETNKLKHWLGLKVYQLIEDPLGFIFLRHLDGGIEDLHEGKSSKRLRYAKAACSQVVLEAKAREGTTRQYDHLGAVVRRQMGRNVAALRSDEDSSEEQQGKWVKLSETIW
Ga0209089_102623462F060975AGGAGMGKTIRNNMVAKHSEKYNKPKTIRDKKKDFYRPDSKREFEEAIEDMGFDEYNRKDAIITQYQDDQARSQEDGWPYED
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.