NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209580_10023475

Scaffold Ga0209580_10023475


Overview

Basic Information
Taxon OID3300027842 Open in IMG/M
Scaffold IDGa0209580_10023475 Open in IMG/M
Source Dataset NameSurface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2764
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire.

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Centralia
CoordinatesLat. (o)40.7999Long. (o)-76.3402Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001812Metagenome / Metatranscriptome631Y
F019040Metagenome / Metatranscriptome232Y

Sequences

Protein IDFamilyRBSSequence
Ga0209580_100234752F019040GAGGMAESMHNSSDIPNFDTYPSTPPDRLLDTKSAERSSLEERAAELGAAAGRIALILRQTKENVENLAQHEIYDRVTNLAENAKARTEQMRRDASLRVQEIAHAAQDKAAELGNQAREKTVELGRQAKNNYFRARLKANQTVREYPVETALAAGAVGLLVGVALRIGRARRAY
Ga0209580_100234754F001812AGGCGGMADTDFTSAPKASSSTYKPQVYDLLNRLNAAYARVHRNMEALQAVGIFDPLMMQKLNRQHEQLRAGANYHLLGAMRRIEERDRDRFSQPPNE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.