NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209501_10100861

Scaffold Ga0209501_10100861


Overview

Basic Information
Taxon OID3300027844 Open in IMG/M
Scaffold IDGa0209501_10100861 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1978
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)75.2588Long. (o)-156.0227Alt. (m)Depth (m)208
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018449Metagenome / Metatranscriptome235N
F103418Metagenome / Metatranscriptome101N

Sequences

Protein IDFamilyRBSSequence
Ga0209501_101008611F018449GAGMNKLLIILLFFLLVGCAGYKPIADLKASKNANDYQEDRQHCKLLIKEEFNAFYAAWYDRELLSRCLNGRGHNVLNTYTIGN
Ga0209501_101008613F103418AGGAGMAFNKDEVIANAQKYGPKSQGKISMFVSQNRTSVDATGKEVIDTKKPSLFGYMTDNDMNMFSISLWKNKDAKKDRDGNTMKDKDGNTVYKITFKGNAEPLGIKQNVIDIKPSNQEKDNLDDIFS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.