NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209501_10292416

Scaffold Ga0209501_10292416


Overview

Basic Information
Taxon OID3300027844 Open in IMG/M
Scaffold IDGa0209501_10292416 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1004
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → environmental samples → uncultured marine virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)75.2588Long. (o)-156.0227Alt. (m)Depth (m)208
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013820Metagenome / Metatranscriptome268Y
F022754Metagenome / Metatranscriptome213Y
F036736Metagenome / Metatranscriptome169Y

Sequences

Protein IDFamilyRBSSequence
Ga0209501_102924161F036736AGGAMISDKFHEMVIGFFVLVGSFTTKRIFKNHDTLSERVSALEKIVLTKEDISGLEKDVSMIVTHLITSKGEK
Ga0209501_102924162F013820AGGAGMTPVISTIIGFIDKAIPGYKTYALMLIGALMMGCQMMGFHSFSQEAWGLLGIGGAATWKMGTDRDTTVQKK
Ga0209501_102924163F022754N/AMLVIPSPHKLVNWSVNKVPTQIQIIHKSGLEVSYNANPVSCKFRPRNANEMVFQSPNDRCYSVYDLSSPTFVRHPNFWHRIELPKSLSLKE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.