Basic Information | |
---|---|
Taxon OID | 3300027844 Open in IMG/M |
Scaffold ID | Ga0209501_10552450 Open in IMG/M |
Source Dataset Name | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 650 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Arctic Ocean: Canada Basin | |||||||
Coordinates | Lat. (o) | 75.2588 | Long. (o) | -156.0227 | Alt. (m) | Depth (m) | 208 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F092694 | Metagenome | 107 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209501_105524502 | F092694 | GAGG | VTFCEARVQVGFPDYLLVDMGIFGLAAWFKAMRERLGDTQKVAEFEKIEVPGDLVIELVKGTKGQFHHRGLTERDIKLSADDAARLFKPDSTYTVELFEV |
⦗Top⦘ |