Basic Information | |
---|---|
Taxon OID | 3300027852 Open in IMG/M |
Scaffold ID | Ga0209345_10549359 Open in IMG/M |
Source Dataset Name | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 655 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Channel Oil Seeps |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Coal Oil Point, Santa Barbara, CA | |||||||
Coordinates | Lat. (o) | 34.39225 | Long. (o) | -119.845662 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F061521 | Metagenome / Metatranscriptome | 131 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209345_105493592 | F061521 | GGAGG | MNGDFLKIEIERIVNLVAGFGWKKVEEKVSGEKVQITLEKTVPVTPGTGE |
⦗Top⦘ |