NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209274_10038716

Scaffold Ga0209274_10038716


Overview

Basic Information
Taxon OID3300027853 Open in IMG/M
Scaffold IDGa0209274_10038716 Open in IMG/M
Source Dataset NameReference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2235
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From The Hubbard Brook Experimental Forest, New Hampshire, Under Manipulated Climate Change Conditions.

Source Dataset Sampling Location
Location NameUSA: New Hampshire, Hubbard Brook experimental Forest
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004502Metagenome / Metatranscriptome435Y
F075137Metagenome / Metatranscriptome119N

Sequences

Protein IDFamilyRBSSequence
Ga0209274_100387161F075137N/AGPDTTFTALTASSSGFTAAGQFGQPGQQQVAAWTSATGTSWTPVPNGGLTAPQTGGSYQISALAPSGHAVTGIGSLATQASQEVFTVSLPAR
Ga0209274_100387162F004502AGAAGVDSDAGKPTQQFRASWQATKDAMSEWSRRVSEATHEALDKIEPAVQAAVEAGRAAMTGKWRDCQCQCGSAHPADAGVCDGRAVMTRRVSGADVSLCAPCAVAQGVAEMKL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.