NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209503_10000198

Scaffold Ga0209503_10000198


Overview

Basic Information
Taxon OID3300027859 Open in IMG/M
Scaffold IDGa0209503_10000198 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)41702
Total Scaffold Genes65 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (16.92%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameSouth Atlantic Ocean
CoordinatesLat. (o)-17.283Long. (o)2.9768Alt. (m)Depth (m)30
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F057920Metagenome / Metatranscriptome135Y
F064368Metagenome / Metatranscriptome128Y
F093339Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0209503_1000019826F057920N/AMDFNSKDYQNIKLKNFFKTNGFFLWFHSAKLDSNKWIQMEQNLKKSKLNYSKVLNGVTLKLFKNSIFTNISPIICSFVLFVGSNFKMTALQFSSVEKHLNPSFKLISAKLNNRIYSTSQLKGLPEFSYRKNMFGLYNALDQHLKTSYLLTITKKKIASK
Ga0209503_1000019830F093339N/AMILSNTLFNTLTNKLELRTVLLQKEKNYTKNLLDQVVSLRKLKENNLGNFSKKKIITNKDGRANLQDFVIAYIVSVSFLRANTMIHVSDTKGNLKLFYSAGSVELSGKQKRKRRVAISKLISLVLKKAKFLNRKPIALHLSNVNFYKNLIVRRLKRNLYVKVIRILNQTPYNGCRKRKLRRKKYTKRFK
Ga0209503_1000019846F064368N/AMKILKNILISSDGSCHFINSGEILLSNKFVTFKKQDDKNFVFNKKKDHSVVDSKQSLHHKRKYLK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.