Basic Information | |
---|---|
Taxon OID | 3300027877 Open in IMG/M |
Scaffold ID | Ga0209293_10607977 Open in IMG/M |
Source Dataset Name | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 577 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Old Woman Creek National Estuarine Research Reserve, Ohio, USA | |||||||
Coordinates | Lat. (o) | 41.2239 | Long. (o) | -82.3039 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000982 | Metagenome / Metatranscriptome | 814 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209293_106079772 | F000982 | N/A | MPQTRLSSSAARLLDHHRLRGRSYPTPRYWERLYQMLEEEAEKRGKTPPPPPLTHALDHEPTDDDRMDRLREQIAWADRNSLLHRVQMFFDTMPTSCW |
⦗Top⦘ |