NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209380_10000382

Scaffold Ga0209380_10000382


Overview

Basic Information
Taxon OID3300027889 Open in IMG/M
Scaffold IDGa0209380_10000382 Open in IMG/M
Source Dataset NameWarmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)31145
Total Scaffold Genes30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)20 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From The Hubbard Brook Experimental Forest, New Hampshire, Under Manipulated Climate Change Conditions.

Source Dataset Sampling Location
Location NameUSA: New Hampshire, Hubbard Brook experimental Forest
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002681Metagenome / Metatranscriptome537Y
F007340Metagenome / Metatranscriptome353Y
F012712Metagenome / Metatranscriptome278Y

Sequences

Protein IDFamilyRBSSequence
Ga0209380_1000038211F007340GGAGMGVRILASVTAVLGAAALTLACMIALVQGTIRAVSIDSIPLRAIAVSADVLLGTFLLLGCVYLATRLAVRILGVGNAEFPALPIDEYSSDVRSGDSARI
Ga0209380_1000038216F002681GGAMSPNSKAESKPERLLGAYLFALCAYQIGIYCWPSGPPFILDPRAGIPVLLINHFSFDNKVIYPVEWITATWLVIAAAMIFFQGKLLRAYLLAEIILAAPTAYYISILAVRHGGDFAPGFKDLVLTALLFLIFSLVPVGLAARRVLARKRLQS
Ga0209380_100003827F012712N/AMRYFLWMRIASLRTGILTGIYLSCVFVAWLEVANRVAELTPFAELRNFVAGAILILVLGIPVLRFRNRPGRLFVAGLTAWTLLTMTYIVAEINFTLLESRMGALHVFVLGAVSYGFVAVLDWVLLMCAGVRHQHMAQSRESAVPAGRHHTH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.