Scaffold Ga0209496_10269419

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209496_10269419

Scaffold Ga0209496_10269419

Overview

Basic Information
Taxon OID	3300027890 Open in IMG/M
Scaffold ID	Ga0209496_10269419 Open in IMG/M
Source Dataset Name	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	841
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa

Source Dataset Sampling Location
Location Name	Old Woman Creek National Estuarine Research Reserve, Ohio, USA
Coordinates	Lat. (^o)	41.224	Long. (^o)	-82.304	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087391	Metagenome / Metatranscriptome	110	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209496_102694191	F087391	GGAG	MKLTKFALLAVAAGCTLASQGVYAQAMEVVTVEAVREIVVGKSPIGAPIKELTIRSRVSYADLDLTTAAGVATLEKRVKDTAASSCKEIKVDVPVEGWTIDRCIREATDDAMVQVNKAVEAAKAAKK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.