Basic Information | |
---|---|
Taxon OID | 3300027891 Open in IMG/M |
Scaffold ID | Ga0209628_10400033 Open in IMG/M |
Source Dataset Name | Cubitermes ugandensis P4 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P4 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1419 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Kakamega Forest, Kenya | |||||||
Coordinates | Lat. (o) | 0.2917 | Long. (o) | 34.856 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000516 | Metagenome | 1062 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209628_104000331 | F000516 | AGG | MSYIYIYIYIYMELLVKPEILTSYIYGPTFGNAETVSFSLLHNVSTLNQCREV |
⦗Top⦘ |